PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000915330
Common NameMYBPA1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 296aa    MW: 33231.2 Da    PI: 9.4255
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000915330genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed ll ++++ +G g+W++ +++ g+ R++k+c++rw +yl
    MDP0000915330 14 RGPWTPREDTLLTKYIEAHGEGHWRSLPKKAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding53.55.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T++Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000915330  67 RGNITPDEDDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      7999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.704961IPR017930Myb domain
SuperFamilySSF466893.48E-3011108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002493.6E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-241568IPR009057Homeodomain-like
CDDcd001672.51E-91661No hitNo description
PROSITE profilePS5129426.81762116IPR017930Myb domain
SMARTSM007172.1E-1666114IPR001005SANT/Myb domain
PfamPF002491.9E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2669116IPR009057Homeodomain-like
CDDcd001672.13E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGRAPCCSKV GLHRGPWTPR EDTLLTKYIE AHGEGHWRSL PKKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI TPDEDDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLSKRLRNEG  120
TDPNTHKKLS EPIARENKRR KNQRSKSNNN KKEMVMTKDK NNKTAQHVEP QKPKVHLPKP  180
TRFTSFLSLP RNDSFTSSTT VTTGSSSQDL NGGGGRGGGG GGFGVNTWCN NGGLVFCVGD  240
EDQDHDPINS SADGGDDHTL ENLYEEYLQA LLKIDHHHDH QNQLELESFA ESLLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24121165108B-MYB
1h8a_C3e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213221GGRGGGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.236550.0fruit| leaf
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9097590.0KJ909759.1 Malus domestica MYBPA1-like transcription factor (MYBPA1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356967.10.0PREDICTED: myb-related protein 308-like
SwissprotP813936e-68MYB08_ANTMA; Myb-related protein 308
SwissprotQ9SZP17e-68MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A075LW640.0A0A075LW64_MALDO; MYBPA1-like transcription factor
STRINGPOPTR_0014s09630.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.14e-68myb domain protein 3
Publications ? help Back to Top
  1. Gesell A,Yoshida K,Tran LT,Constabel CP
    Characterization of an apple TT2-type R2R3 MYB transcription factor functionally similar to the poplar proanthocyanidin regulator PtMYB134.
    Planta, 2014. 240(3): p. 497-511
    [PMID:24923676]